Lineage for d1hklh1 (1hkl H:1-114)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929498Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 929919Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 929939Domain d1hklh1: 1hkl H:1-114 [20089]
    Other proteins in same PDB: d1hklh2, d1hkll1, d1hkll2
    part of humanized Fab 48G7

Details for d1hklh1

PDB Entry: 1hkl (more details), 2.68 Å

PDB Description: free and liganded form of an esterolytic catalytic antibody
PDB Compounds: (H:) 48g7 fab

SCOPe Domain Sequences for d1hklh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hklh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpkqglewigridpanvdtky
dpkfqdkatitadtsskttylqlssltsedtavyycasyygiywgqgttltvssa

SCOPe Domain Coordinates for d1hklh1:

Click to download the PDB-style file with coordinates for d1hklh1.
(The format of our PDB-style files is described here.)

Timeline for d1hklh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hklh2