SCOP 1.61: Domain d1hklh1: 1hkl H:1-114

Lineage for d1hklh1 (1hkl H:1-114)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 48G7 (mouse/human), kappa L chain [48810] (4 PDB entries)

8. Domain d1hklh1: 1hkl H:1-114 [20089]
   Other proteins in same PDB: d1hklh2, d1hkll2

Details for d1hklh1

PDB Entry: 1hkl, 2.7 Å

PDB Description: free and liganded form of an esterolytic catalytic antibody

SCOP Domain Sequences for d1hklh1:

Sequence; same for both SEQRES and ATOM records:

>d1hklh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpkqglewigridpanvdtky
dpkfqdkatitadtsskttylqlssltsedtavyycasyygiywgqgttltvssa

Timeline for d1hklh1:

• d1hklh1 first appeared (with stable ids) in SCOP 1.55
  
• d1hklh1 appears in SCOP 1.59
  
• d1hklh1 appears in SCOP 1.63
  
• d1hklh1 appears in the current release, SCOPe 2.08