Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (30 PDB entries) SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) |
Domain d1hklh1: 1hkl H:9-114 [20089] Other proteins in same PDB: d1hklh2, d1hklh3, d1hkll1, d1hkll2 part of humanized Fab 48G7 |
PDB Entry: 1hkl (more details), 2.68 Å
SCOPe Domain Sequences for d1hklh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hklh1 b.1.1.1 (H:9-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]} aelvkpgasvklsctasgfnikdtymhwvkqrpkqglewigridpanvdtkydpkfqdka titadtsskttylqlssltsedtavyycasyygiywgqgttltvssa
Timeline for d1hklh1: