Lineage for d3tvmg1 (3tvm G:1-117)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1520888Domain d3tvmg1: 3tvm G:1-117 [200889]
    Other proteins in same PDB: d3tvma1, d3tvma2, d3tvmb_, d3tvmc2, d3tvmd1, d3tvmd2, d3tvme1, d3tvme2, d3tvmf_, d3tvmg2, d3tvmh1, d3tvmh2
    automated match to d1qrnd1
    complexed with 07p, cl, gol, nag

Details for d3tvmg1

PDB Entry: 3tvm (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-smc124-inkt tcr complex
PDB Compounds: (G:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3tvmg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tvmg1 b.1.1.0 (G:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d3tvmg1:

Click to download the PDB-style file with coordinates for d3tvmg1.
(The format of our PDB-style files is described here.)

Timeline for d3tvmg1: