Lineage for d3tvme1 (3tvm E:7-185)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1406890Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1406891Protein automated matches [226842] (3 species)
    not a true protein
  7. 1406914Species Mouse (Mus musculus) [TaxId:10090] [224924] (24 PDB entries)
  8. 1406938Domain d3tvme1: 3tvm E:7-185 [200887]
    Other proteins in same PDB: d3tvma2, d3tvmb_, d3tvmc1, d3tvmc2, d3tvmd1, d3tvmd2, d3tvme2, d3tvmf_, d3tvmg1, d3tvmg2, d3tvmh1, d3tvmh2
    automated match to d1onqa2
    complexed with 07p, cl, gol, nag

Details for d3tvme1

PDB Entry: 3tvm (more details), 2.8 Å

PDB Description: Structure of the mouse CD1d-SMC124-iNKT TCR complex
PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3tvme1:

Sequence, based on SEQRES records: (download)

>d3tvme1 d.19.1.0 (E:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records): (download)

>d3tvme1 d.19.1.0 (E:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemasesflhvafqgkyvvrfwg
tswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3tvme1:

Click to download the PDB-style file with coordinates for d3tvme1.
(The format of our PDB-style files is described here.)

Timeline for d3tvme1: