SCOP 1.73: Domain d1hkll1: 1hkl L:1-109

Lineage for d1hkll1 (1hkl L:1-109)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1hkll1: 1hkl L:1-109 [20088]
   Other proteins in same PDB: d1hklh1, d1hklh2, d1hkll2
   part of humanized Fab 48G7

Details for d1hkll1

PDB Entry: 1hkl, 2.7 Å

PDB Description: free and liganded form of an esterolytic catalytic antibody

PDB Compounds: (L:) 48g7 fab

SCOP Domain Sequences for d1hkll1:

Sequence; same for both SEQRES and ATOM records:

>d1hkll1 b.1.1.1 (L:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqspsslsaslgervsltcrasqeingylgwlqqkpdgtikrliyaastlhsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrt

Timeline for d1hkll1:

• d1hkll1 first appeared (with stable ids) in SCOP 1.55
  
• d1hkll1 appears in SCOP 1.71
  
• d1hkll1 appears in SCOP 1.75
  
• d1hkll1 appears in the current release, SCOPe 2.08