Lineage for d3tsrb_ (3tsr B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174918Protein automated matches [190061] (7 species)
    not a true protein
  7. 2175056Species Mouse (Mus musculus) [TaxId:10090] [187495] (5 PDB entries)
  8. 2175063Domain d3tsrb_: 3tsr B: [200873]
    Other proteins in same PDB: d3tsre1, d3tsre2, d3tsrf1, d3tsrf2, d3tsrg1, d3tsrg2, d3tsrh1, d3tsrh2
    automated match to d3tsra_
    complexed with edo, peg

Details for d3tsrb_

PDB Entry: 3tsr (more details), 2.2 Å

PDB Description: x-ray structure of mouse ribonuclease inhibitor complexed with mouse ribonuclease 1
PDB Compounds: (B:) ribonuclease pancreatic

SCOPe Domain Sequences for d3tsrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tsrb_ d.5.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
esaaqkfqrqhmdpdgssinsptycnqmmkrrdmtngsckpvntfvhepladvqavcsqe
nvtcknrksncyksssalhitdchlkgnskypncdykttqyqkhiivacegnpyvpvhfd
atv

SCOPe Domain Coordinates for d3tsrb_:

Click to download the PDB-style file with coordinates for d3tsrb_.
(The format of our PDB-style files is described here.)

Timeline for d3tsrb_: