SCOPe 2.02: Domain d2rcsh1: 2rcs H:1-114

Lineage for d2rcsh1 (2rcs H:1-114)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
   SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)

8. Domain d2rcsh1: 2rcs H:1-114 [20087]
   Other proteins in same PDB: d2rcsh2, d2rcsl1, d2rcsl2
   part of humanized Fab 48G7

Details for d2rcsh1

PDB Entry: 2rcs, 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody

PDB Compounds: (H:) immunoglobulin 48g7 germline fab

SCOPe Domain Sequences for d2rcsh1:

Sequence; same for both SEQRES and ATOM records:

>d2rcsh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycasyygiywgqgttltvssa

Timeline for d2rcsh1:

• d2rcsh1 first appeared (with stable ids) in SCOP 1.55
  
• d2rcsh1 appears in SCOPe 2.01
  
• d2rcsh1 appears in SCOPe 2.03
  
• d2rcsh1 appears in the current release, SCOPe 2.08