SCOP 1.59: Domain d2rcsh1: 2rcs H:1-114

Lineage for d2rcsh1 (2rcs H:1-114)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Fab 48G7 (mouse/human), kappa L chain [48810] (4 PDB entries)

8. Domain d2rcsh1: 2rcs H:1-114 [20087]
   Other proteins in same PDB: d2rcsh2, d2rcsl2

Details for d2rcsh1

PDB Entry: 2rcs, 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody

SCOP Domain Sequences for d2rcsh1:

Sequence; same for both SEQRES and ATOM records:

>d2rcsh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycasyygiywgqgttltvssa

Timeline for d2rcsh1:

• d2rcsh1 first appeared (with stable ids) in SCOP 1.55
  
• d2rcsh1 appears in SCOP 1.57
  
• d2rcsh1 appears in SCOP 1.61
  
• d2rcsh1 appears in the current release, SCOPe 2.08