Lineage for d3trra_ (3trr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2853595Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2853596Protein automated matches [190246] (71 species)
    not a true protein
  7. 2853886Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)
  8. 2853896Domain d3trra_: 3trr A: [200867]
    automated match to d3trrf_
    complexed with edo, gol, peg

Details for d3trra_

PDB Entry: 3trr (more details), 2.09 Å

PDB Description: crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
PDB Compounds: (A:) Probable enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3trra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trra_ c.14.1.0 (A:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
madevlieqrdrvllitinrpdarnavnravsqglaaaadqldssadlsvaiitgaggnf
cagmdlkafvsgeavlserglgftnvpprkpiiaavegfalaggtelvlscdlvvagrsa
kfgipevkrglvagaggllrlpnripyqvamelaltgesftaedaakygfinrlvddgqa
ldtalelaakitangplavaatkriiiesaswapeeafakqgeilmpifvsedakegaka
faekrapvwqgk

SCOPe Domain Coordinates for d3trra_:

Click to download the PDB-style file with coordinates for d3trra_.
(The format of our PDB-style files is described here.)

Timeline for d3trra_: