Lineage for d1aj7h1 (1aj7 H:1-114)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287384Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (28 PDB entries)
  8. 287394Domain d1aj7h1: 1aj7 H:1-114 [20085]
    Other proteins in same PDB: d1aj7h2, d1aj7l1, d1aj7l2
    part of humanized Fab 48G7
    complexed with npe

Details for d1aj7h1

PDB Entry: 1aj7 (more details), 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab antibody complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid. affinity maturation of an esterolytic antibody
PDB Compounds: (H:)

SCOP Domain Sequences for d1aj7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aj7h1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1}
qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycasyygiywgqgttltvssa

SCOP Domain Coordinates for d1aj7h1:

Click to download the PDB-style file with coordinates for d1aj7h1.
(The format of our PDB-style files is described here.)

Timeline for d1aj7h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aj7h2