Lineage for d1aj7h1 (1aj7 H:1-114)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102447Species Fab 48G7 (mouse/human), kappa L chain [48810] (4 PDB entries)
  8. 102450Domain d1aj7h1: 1aj7 H:1-114 [20085]
    Other proteins in same PDB: d1aj7h2, d1aj7l2

Details for d1aj7h1

PDB Entry: 1aj7 (more details), 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab antibody complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid. affinity maturation of an esterolytic antibody

SCOP Domain Sequences for d1aj7h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aj7h1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycasyygiywgqgttltvssa

SCOP Domain Coordinates for d1aj7h1:

Click to download the PDB-style file with coordinates for d1aj7h1.
(The format of our PDB-style files is described here.)

Timeline for d1aj7h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aj7h2