Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Fab 48G7 (mouse/human), kappa L chain [48810] (4 PDB entries) |
Domain d1aj7l1: 1aj7 L:1-109 [20084] Other proteins in same PDB: d1aj7h2, d1aj7l2 |
PDB Entry: 1aj7 (more details), 2.1 Å
SCOP Domain Sequences for d1aj7l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aj7l1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain} diqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrt
Timeline for d1aj7l1: