SCOP 1.55: Domain d1aj7l1: 1aj7 L:1-109

Lineage for d1aj7l1 (1aj7 L:1-109)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 48G7 (mouse/human), kappa L chain [48810] (4 PDB entries)

8. Domain d1aj7l1: 1aj7 L:1-109 [20084]
   Other proteins in same PDB: d1aj7h2, d1aj7l2

Details for d1aj7l1

PDB Entry: 1aj7, 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab antibody complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid. affinity maturation of an esterolytic antibody

SCOP Domain Sequences for d1aj7l1:

Sequence; same for both SEQRES and ATOM records:

>d1aj7l1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
diqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrt

Timeline for d1aj7l1:

• d1aj7l1 appears in SCOP 1.57
  
• d1aj7l1 appears in the current release, SCOPe 2.08