SCOPe 2.06: Domain d3tlra1: 3tlr A:1-99

Lineage for d3tlra1 (3tlr A:1-99)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein beta2-microglobulin [88600] (6 species)
Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries)
Uniprot P61769 21-119 ! Uniprot P01884
Domain d3tlra1: 3tlr A:1-99 [200834]
Other proteins in same PDB: d3tlra2, d3tlrb2, d3tlrc2, d3tlrd2
automated match to d3tlrc_
complexed with cd, na; mutant

Details for d3tlra1

PDB Entry: 3tlr (more details), 2.45 Å

PDB Description: Crystal Structure of the tetrameric Beta-2 microglobulin DIMC20 mutant

PDB Compounds: (A:) Beta-2-microglobulin

SCOPe Domain Sequences for d3tlra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tlra1 b.1.1.2 (A:1-99) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
iqrtpkiqvysrhpaengkcnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw
sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

SCOPe Domain Coordinates for d3tlra1:

Click to download the PDB-style file with coordinates for d3tlra1.
(The format of our PDB-style files is described here.)

Timeline for d3tlra1: