SCOP 1.73: Domain d1gafh1: 1gaf H:1-114

Lineage for d1gafh1 (1gaf H:1-114)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (34 PDB entries)

8. Domain d1gafh1: 1gaf H:1-114 [20083]
   Other proteins in same PDB: d1gafh2, d1gafl1, d1gafl2
   part of humanized Fab 48G7
   complexed with npe

Details for d1gafh1

PDB Entry: 1gaf, 1.95 Å

PDB Description: 48g7 hybridoma line fab complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid

PDB Compounds: (H:) chimeric 48g7 fab

SCOP Domain Sequences for d1gafh1:

Sequence; same for both SEQRES and ATOM records:

>d1gafh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpkqglewigridpanvdtky
dpkfqdkatitadtsskttylqlssltsedtavyycasyygiywgqgttltvss

Timeline for d1gafh1:

• d1gafh1 first appeared (with stable ids) in SCOP 1.55
  
• d1gafh1 appears in SCOP 1.71
  
• d1gafh1 appears in SCOP 1.75
  
• d1gafh1 appears in the current release, SCOPe 2.08