SCOP 1.55: Domain d1gafl1: 1gaf L:1-109

Lineage for d1gafl1 (1gaf L:1-109)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 48G7 (mouse/human), kappa L chain [48810] (4 PDB entries)

8. Domain d1gafl1: 1gaf L:1-109 [20082]
   Other proteins in same PDB: d1gafh2, d1gafl2

Details for d1gafl1

PDB Entry: 1gaf, 1.95 Å

PDB Description: 48g7 hybridoma line fab complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid

SCOP Domain Sequences for d1gafl1:

Sequence; same for both SEQRES and ATOM records:

>d1gafl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
diqmtqspsslsaslgervsltcrasqeingylgwlqqkpdgtikrliyaastlhsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrt

Timeline for d1gafl1:

• d1gafl1 appears in SCOP 1.57
  
• d1gafl1 appears in the current release, SCOPe 2.08