Lineage for d1plgl1 (1plg L:1-112)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158568Species Polysialic acid-binding Fab (mouse), kappa L chain [48809] (1 PDB entry)
  8. 158570Domain d1plgl1: 1plg L:1-112 [20080]
    Other proteins in same PDB: d1plgh2, d1plgl2

Details for d1plgl1

PDB Entry: 1plg (more details), 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plgl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Polysialic acid-binding Fab (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylywylqkpgqspkpliyrvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcfqgthvpytfgggtrleik

SCOP Domain Coordinates for d1plgl1:

Click to download the PDB-style file with coordinates for d1plgl1.
(The format of our PDB-style files is described here.)

Timeline for d1plgl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1plgl2