SCOP 1.55: Domain d1plgl1: 1plg L:1-112

Lineage for d1plgl1 (1plg L:1-112)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Polysialic acid-binding Fab (mouse), kappa L chain [48809] (1 PDB entry)

8. Domain d1plgl1: 1plg L:1-112 [20080]
   Other proteins in same PDB: d1plgh2, d1plgl2

Details for d1plgl1

PDB Entry: 1plg, 2.8 Å

PDB Description: evidence for the extended helical nature of polysaccharide epitopes. the 2.8 angstroms resolution structure and thermodynamics of ligand binding of an antigen binding fragment specific for alpha-(2->8)-polysialic acid

SCOP Domain Sequences for d1plgl1:

Sequence; same for both SEQRES and ATOM records:

>d1plgl1 b.1.1.1 (L:1-112) Immunoglobulin (variable domains of L and H chains) {Polysialic acid-binding Fab (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylywylqkpgqspkpliyrvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcfqgthvpytfgggtrleik

Timeline for d1plgl1:

• d1plgl1 appears in SCOP 1.57
  
• d1plgl1 appears in the current release, SCOPe 2.08