SCOPe 2.05: Domain d1aifh1: 1aif H:1-121

Lineage for d1aifh1 (1aif H:1-121)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (63 PDB entries)
Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
Domain d1aifh1: 1aif H:1-121 [20079]
Other proteins in same PDB: d1aifa1, d1aifa2, d1aifb2, d1aifh2, d1aifl1, d1aifl2
part of Fab 409.5.3

Details for d1aifh1

PDB Entry: 1aif (more details), 2.9 Å

PDB Description: anti-idiotypic fab 409.5.3 (igg2a) fab from mouse

PDB Compounds: (H:) anti-idiotypic fab 409.5.3 (igg2a) fab (heavy chain)

SCOPe Domain Sequences for d1aifh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aifh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
s

SCOPe Domain Coordinates for d1aifh1:

Click to download the PDB-style file with coordinates for d1aifh1.
(The format of our PDB-style files is described here.)

Timeline for d1aifh1: