SCOP 1.61: Domain d1aifh1: 1aif H:1-121

Lineage for d1aifh1 (1aif H:1-121)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 409.5.3 (mouse), kappa L chain [48808] (2 PDB entries)

8. Domain d1aifh1: 1aif H:1-121 [20079]
   Other proteins in same PDB: d1aifa2, d1aifb2, d1aifh2, d1aifl2

Details for d1aifh1

PDB Entry: 1aif, 2.9 Å

PDB Description: anti-idiotypic fab 409.5.3 (igg2a) fab from mouse

SCOP Domain Sequences for d1aifh1:

Sequence; same for both SEQRES and ATOM records:

>d1aifh1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain}
evklqesggglvqpggsmklscvasgftfnnywmswvrqspekglewvaeirlnsdnfat
hyaesvkgkfiisrddsksrlylqmnslraedtgiyycvlrplfyyavdywgqgtsvtvs
s

Timeline for d1aifh1:

• d1aifh1 first appeared (with stable ids) in SCOP 1.55
  
• d1aifh1 appears in SCOP 1.59
  
• d1aifh1 appears in SCOP 1.63
  
• d1aifh1 appears in the current release, SCOPe 2.08