Lineage for d3ta3a2 (3ta3 A:186-279)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030940Domain d3ta3a2: 3ta3 A:186-279 [200784]
    Other proteins in same PDB: d3ta3a1, d3ta3b_, d3ta3c1, d3ta3d1
    automated match to d1onqa1
    complexed with 3tf, nag

Details for d3ta3a2

PDB Entry: 3ta3 (more details), 2.7 Å

PDB Description: structure of the mouse cd1d-glc-dag-s2-inkt tcr complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3ta3a2:

Sequence, based on SEQRES records: (download)

>d3ta3a2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3ta3a2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvprqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatl
dveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3ta3a2:

Click to download the PDB-style file with coordinates for d3ta3a2.
(The format of our PDB-style files is described here.)

Timeline for d3ta3a2: