Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab 409.5.3 (mouse), kappa L chain [48808] (2 PDB entries) |
Domain d1aifl1: 1aif L:1-109 [20078] Other proteins in same PDB: d1aifa2, d1aifb2, d1aifh2, d1aifl2 |
PDB Entry: 1aif (more details), 2.9 Å
SCOP Domain Sequences for d1aifl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aifl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain} diqltqspafmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp vrfsgsgsgtsysltissmeaedaatyycqqwnsypytfgggtkleikr
Timeline for d1aifl1: