Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Escherichia coli [TaxId:562] [196212] (2 PDB entries) |
Domain d3t89b_: 3t89 B: [200770] automated match to d3t89f_ complexed with gol, mli |
PDB Entry: 3t89 (more details), 1.95 Å
SCOPe Domain Sequences for d3t89b_:
Sequence, based on SEQRES records: (download)
>d3t89b_ c.14.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada ryddnigviiltgagdkafcsggdqkvrgdyggykddsgvhhlnvldfqrqirtcpkpvv amvagysiggghvlhmmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkarei wflcrqydakqaldmglvntvvpladleketvrwcremlqnspmalrclkaalnadcdgq aglqelagnatmlfymteegqegrnafnqkrqpdfskfkrnp
>d3t89b_ c.14.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]} pdeamlyapvewhdcsegfediryekstdgiakitinrpqvrnafrpltvkemiqalada ryddnigviiltgagdkafcsggdqkvlnvldfqrqirtcpkpvvamvagysiggghvlh mmcdltiaadnaifgqtgpkvgsfdggwgasymarivgqkkareiwflcrqydakqaldm glvntvvpladleketvrwcremlqnspmalrclkaalnadcdgqaglqelagnatmlfy mteegqegrnafqpdfskfkrnp
Timeline for d3t89b_: