SCOPe 2.03: Domain d3t6eh1: 3t6e H:1-36

Lineage for d3t6eh1 (3t6e H:1-36)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (3 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (15 PDB entries)
   synonym: blastochloris viridis

8. Domain d3t6eh1: 3t6e H:1-36 [200766]
   Other proteins in same PDB: d3t6ec_, d3t6eh2, d3t6el_, d3t6em_
   automated match to d6prch2
   complexed with bcb, bpb, dga, fe2, gol, hec, hto, lda, mq9, ns5, so4, uq9

Details for d3t6eh1

PDB Entry: 3t6e, 1.92 Å

PDB Description: Crystal Structure of the Reaction Centre from Blastochloris viridis strain DSM 133 (ATCC 19567) substrain-94

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3t6eh1:

Sequence; same for both SEQRES and ATOM records:

>d3t6eh1 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d3t6eh1:

• d3t6eh1 is new in SCOPe 2.03-stable
  
• d3t6eh1 appears in SCOPe 2.04
  
• d3t6eh1 appears in the current release, SCOPe 2.08