SCOP 1.71: Domain d1aifa1: 1aif A:1-109

Lineage for d1aifa1 (1aif A:1-109)

Root: SCOP 1.71
Class b: All beta proteins [48724] (149 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (12 PDB entries)
Domain d1aifa1: 1aif A:1-109 [20076]
Other proteins in same PDB: d1aifa2, d1aifb1, d1aifb2, d1aifh1, d1aifh2, d1aifl2

Details for d1aifa1

PDB Entry: 1aif (more details), 2.9 Å

PDB Description: anti-idiotypic fab 409.5.3 (igg2a) fab from mouse

SCOP Domain Sequences for d1aifa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aifa1 b.1.1.1 (A:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1}
diqltqspafmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
vrfsgsgsgtsysltissmeaedaatyycqqwnsypytfgggtkleikr

SCOP Domain Coordinates for d1aifa1:

Click to download the PDB-style file with coordinates for d1aifa1.
(The format of our PDB-style files is described here.)

Timeline for d1aifa1: