SCOPe 2.03: Domain d3t32a_: 3t32 A:

Lineage for d3t32a_ (3t32 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:261594] [189194] (3 PDB entries)

8. Domain d3t32a_: 3t32 A: [200741]
   automated match to d3t32b_

Details for d3t32a_

PDB Entry: 3t32, 2 Å

PDB Description: crystal structure of a putative c-s lyase from bacillus anthracis

PDB Compounds: (A:) Aminotransferase, class I/II

SCOPe Domain Sequences for d3t32a_:

Sequence; same for both SEQRES and ATOM records:

>d3t32a_ c.67.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
eelihawiadmdfevpqpiqtalkkriehpifgytlppenigdiicnwtkkqynwdiqke
wivfsagivpalstsiqaftkenesvlvqppiyppffemvttnnrqlcvsplqkqndtya
idfehlekqfqqgvklmllcsphnpigrvwkkeeltklgslctkynvivvadeihsdiiy
adhthtpfaslseelaartitcmapsktfniaglqasiiiipneklrqaftsiqyrqgfh
glnifaytamqsaytecndwlneirfyiednakfaceyikdhiptlsvmkpegsfllwid
csalnlsqdertklleekgkiivepgekyglggeehiginigcprsvleeilnrlrhtfs

Timeline for d3t32a_:

• d3t32a_ is new in SCOPe 2.03-stable
  
• d3t32a_ appears in SCOPe 2.04
  
• d3t32a_ appears in the current release, SCOPe 2.08