Lineage for d3t1fa2 (3t1f A:186-279)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030602Domain d3t1fa2: 3t1f A:186-279 [200740]
    Other proteins in same PDB: d3t1fa1, d3t1fb_
    automated match to d1onqa1
    complexed with 3tf, gol, nag

Details for d3t1fa2

PDB Entry: 3t1f (more details), 1.7 Å

PDB Description: crystal structure of the mouse cd1d-glc-dag-s2 complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3t1fa2:

Sequence, based on SEQRES records: (download)

>d3t1fa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3t1fa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpshghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwyl
qatldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3t1fa2:

Click to download the PDB-style file with coordinates for d3t1fa2.
(The format of our PDB-style files is described here.)

Timeline for d3t1fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3t1fa1
View in 3D
Domains from other chains:
(mouse over for more information)
d3t1fb_