SCOPe 2.03: Domain d3t1fa2: 3t1f A:186-279

Lineage for d3t1fa2 (3t1f A:186-279)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d3t1fa2: 3t1f A:186-279 [200740]
   Other proteins in same PDB: d3t1fa1, d3t1fb_
   automated match to d1onqa1
   complexed with 3tf, gol, nag

Details for d3t1fa2

PDB Entry: 3t1f, 1.7 Å

PDB Description: crystal structure of the mouse cd1d-glc-dag-s2 complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3t1fa2:

Sequence, based on SEQRES records:

>d3t1fa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records):

>d3t1fa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpshghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwyl
qatldveageeaglacrvkhsslggqdiilyw

Timeline for d3t1fa2:

• d3t1fa2 is new in SCOPe 2.03-stable
  
• d3t1fa2 appears in SCOPe 2.04
  
• d3t1fa2 appears in the current release, SCOPe 2.08