Lineage for d1iaim1 (1iai M:1-109)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102440Species Fab 409.5.3 (mouse), kappa L chain [48808] (2 PDB entries)
  8. 102442Domain d1iaim1: 1iai M:1-109 [20074]
    Other proteins in same PDB: d1iaih2, d1iaii2, d1iail2, d1iaim2

Details for d1iaim1

PDB Entry: 1iai (more details), 2.9 Å

PDB Description: idiotype-anti-idiotype fab complex

SCOP Domain Sequences for d1iaim1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaim1 b.1.1.1 (M:1-109) Immunoglobulin (variable domains of L and H chains) {Fab 409.5.3 (mouse), kappa L chain}
diqltqspafmaaspgekvtitcsvsssisssnlhwyqqksetspkpwiygtsnlasgvp
vrfsgsgsgtsysltissmeaedaatyycqqwnsypytfgggtkleikr

SCOP Domain Coordinates for d1iaim1:

Click to download the PDB-style file with coordinates for d1iaim1.
(The format of our PDB-style files is described here.)

Timeline for d1iaim1: