SCOPe 2.08: Domain d3szid1: 3szi D:3-121

Lineage for d3szid1 (3szi D:3-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.0: automated matches [191402] (1 protein)
   not a true family

6. Protein automated matches [190537] (10 species)
   not a true protein

7. Species Shewanella denitrificans [TaxId:318161] [195517] (5 PDB entries)

8. Domain d3szid1: 3szi D:3-121 [200735]
   Other proteins in same PDB: d3szid2, d3szig2, d3szij2
   automated match to d3szig_
   complexed with fmt

Details for d3szid1

PDB Entry: 3szi, 1.4 Å

PDB Description: Structure of apo shwanavidin (P21 form)

PDB Compounds: (D:) Avidin/streptavidin

SCOPe Domain Sequences for d3szid1:

Sequence; same for both SEQRES and ATOM records:

>d3szid1 b.61.1.0 (D:3-121) automated matches {Shewanella denitrificans [TaxId: 318161]}
maqeltamsawvnqdgstlyinsinaqgeltgsyinraagfacqnspypvngwvfgtais
fstkwlnsvescnsitswsgfyintggqgkistlwqlvvngssspsqilkgqdvfsqts

Timeline for d3szid1:

• d3szid1 first appeared in SCOPe 2.03, called d3szid_
  
• d3szid1 appears in SCOPe 2.07