SCOP 1.73: Domain d1iaih1: 1iai H:1-121

Lineage for d1iaih1 (1iai H:1-121)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)

8. Domain d1iaih1: 1iai H:1-121 [20073]
   Other proteins in same PDB: d1iaih2, d1iaii2, d1iail1, d1iail2, d1iaim1, d1iaim2
   part of Fab 730.1.4

Details for d1iaih1

PDB Entry: 1iai, 2.9 Å

PDB Description: idiotype-anti-idiotype fab complex

PDB Compounds: (H:) idiotypic fab 730.1.4 (igg1) of virus neutralizing antibody

SCOP Domain Sequences for d1iaih1:

Sequence; same for both SEQRES and ATOM records:

>d1iaih1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmawintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcardgyyenyyamdywgqgtsvtvs
s

Timeline for d1iaih1:

• d1iaih1 first appeared (with stable ids) in SCOP 1.55
  
• d1iaih1 appears in SCOP 1.71
  
• d1iaih1 appears in SCOP 1.75
  
• d1iaih1 appears in the current release, SCOPe 2.08