Lineage for d1iaih1 (1iai H:1-121)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7480Species Fab 730.1.4 (mouse), kappa L chain [48807] (1 PDB entry)
  8. 7481Domain d1iaih1: 1iai H:1-121 [20073]
    Other proteins in same PDB: d1iaih2, d1iaii2, d1iail2, d1iaim2

Details for d1iaih1

PDB Entry: 1iai (more details), 2.9 Å

PDB Description: idiotype-anti-idiotype fab complex

SCOP Domain Sequences for d1iaih1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iaih1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Fab 730.1.4 (mouse), kappa L chain}
qiqlvqsgpelkkpgetvkisckasgytftnygmnwvkqapgkglkwmawintytgepty
addfkgrfafsletsastaylqinnlknedtatyfcardgyyenyyamdywgqgtsvtvs
s

SCOP Domain Coordinates for d1iaih1:

Click to download the PDB-style file with coordinates for d1iaih1.
(The format of our PDB-style files is described here.)

Timeline for d1iaih1: