Lineage for d3sw5c_ (3sw5 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790734Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families) (S)
  5. 2790901Family b.40.5.0: automated matches [191399] (1 protein)
    not a true family
  6. 2790902Protein automated matches [190523] (12 species)
    not a true protein
  7. 2790906Species Bartonella henselae [TaxId:38323] [196244] (1 PDB entry)
  8. 2790909Domain d3sw5c_: 3sw5 C: [200714]
    automated match to d3sw5f_
    complexed with lmr

Details for d3sw5c_

PDB Entry: 3sw5 (more details), 2 Å

PDB Description: crystal structure of inorganic pyrophosphatase from bartonella henselae
PDB Compounds: (C:) inorganic pyrophosphatase

SCOPe Domain Sequences for d3sw5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sw5c_ b.40.5.0 (C:) automated matches {Bartonella henselae [TaxId: 38323]}
ikeiavgknppedvnvivevslggqpikyemdkksgalfvdrflytsmvypgnygfvpht
lsedgdpidvlicntrpllpgcvinvypigalimeddggkdekiiaiptpkltqrynnih
dytdlpeitlkqiehffehykdlepgkwakiegwrdksfahelikqaiernk

SCOPe Domain Coordinates for d3sw5c_:

Click to download the PDB-style file with coordinates for d3sw5c_.
(The format of our PDB-style files is described here.)

Timeline for d3sw5c_: