Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species Fab N10 (mouse), kappa L chain [48806] (1 PDB entry) |
Domain d1nsnh1: 1nsn H:1-114 [20071] Other proteins in same PDB: d1nsnh2, d1nsnl2, d1nsns_ |
PDB Entry: 1nsn (more details), 2.9 Å
SCOP Domain Sequences for d1nsnh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsnh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab N10 (mouse), kappa L chain} dvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgttsy npslksrisisrdtsknqffmqlnsvttedtgtfyctrgngdwgqgttltvssa
Timeline for d1nsnh1: