Lineage for d1nsnh1 (1nsn H:1-114)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102822Species Fab N10 (mouse), kappa L chain [48806] (1 PDB entry)
  8. 102823Domain d1nsnh1: 1nsn H:1-114 [20071]
    Other proteins in same PDB: d1nsnh2, d1nsnl2, d1nsns_

Details for d1nsnh1

PDB Entry: 1nsn (more details), 2.9 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution

SCOP Domain Sequences for d1nsnh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsnh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab N10 (mouse), kappa L chain}
dvqlqesgpglvkpsqslsltctvtgysitsdyawnwirqfpgnklewmgyitysgttsy
npslksrisisrdtsknqffmqlnsvttedtgtfyctrgngdwgqgttltvssa

SCOP Domain Coordinates for d1nsnh1:

Click to download the PDB-style file with coordinates for d1nsnh1.
(The format of our PDB-style files is described here.)

Timeline for d1nsnh1: