SCOPe 2.03: Domain d3svha_: 3svh A:

Lineage for d3svha_ (3svh A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (5 proteins)

6. Protein automated matches [190366] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (16 PDB entries)

8. Domain d3svha_: 3svh A: [200702]
   automated match to d3p1fa_
   complexed with edo, krg

Details for d3svha_

PDB Entry: 3svh, 1.8 Å

PDB Description: Crystal Structure of the bromdomain of human CREBBP in complex with a 3,5-dimethylisoxazol ligand

PDB Compounds: (A:) creb-binding protein

SCOPe Domain Sequences for d3svha_:

Sequence; same for both SEQRES and ATOM records:

>d3svha_ a.29.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d3svha_:

• d3svha_ is new in SCOPe 2.03-stable
  
• d3svha_ appears in SCOPe 2.04
  
• d3svha_ appears in the current release, SCOPe 2.08