SCOP 1.75: Domain d1nsnl1: 1nsn L:1-107

Lineage for d1nsnl1 (1nsn L:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)

8. Domain d1nsnl1: 1nsn L:1-107 [20070]
   Other proteins in same PDB: d1nsnh1, d1nsnh2, d1nsnl2, d1nsns_
   part of Fab N10

Details for d1nsnl1

PDB Entry: 1nsn, 2.8 Å

PDB Description: the crystal structure of antibody n10-staphylococcal nuclease complex at 2.9 angstroms resolution

PDB Compounds: (L:) igg fab (igg1, kappa)

SCOP Domain Sequences for d1nsnl1:

Sequence; same for both SEQRES and ATOM records:

>d1nsnl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspsslavslgqratiscrasqsvstssfrymhwyqqkpgqpprllikyasnles
gvparfsgsgsgtdftlnihpveeedtatyycqhsweipytfgggtkleik

Timeline for d1nsnl1:

• d1nsnl1 first appeared (with stable ids) in SCOP 1.55
  
• d1nsnl1 appears in SCOP 1.73
  
• d1nsnl1 appears in SCOPe 2.01
  
• d1nsnl1 appears in the current release, SCOPe 2.08