Lineage for d1opgh1 (1opg H:1-125)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102117Species Anti-integrin Fab OPG2 (mouse), kappa L chain [48805] (2 PDB entries)
  8. 102120Domain d1opgh1: 1opg H:1-125 [20069]
    Other proteins in same PDB: d1opgh2, d1opgl2

Details for d1opgh1

PDB Entry: 1opg (more details), 2 Å

PDB Description: opg2 fab fragment

SCOP Domain Sequences for d1opgh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opgh1 b.1.1.1 (H:1-125) Immunoglobulin (variable domains of L and H chains) {Anti-integrin Fab OPG2 (mouse), kappa L chain}
evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhpfyrydggnyyamdhwgqgts
vtvsa

SCOP Domain Coordinates for d1opgh1:

Click to download the PDB-style file with coordinates for d1opgh1.
(The format of our PDB-style files is described here.)

Timeline for d1opgh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1opgh2