Lineage for d3so3b1 (3so3 B:1-106A)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758005Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
  8. 1758054Domain d3so3b1: 3so3 B:1-106A [200683]
    Other proteins in same PDB: d3so3a_, d3so3b2
    automated match to d1rhha1
    complexed with gol, suc

Details for d3so3b1

PDB Entry: 3so3 (more details), 2.1 Å

PDB Description: structures of fab-protease complexes reveal a highly specific non- canonical mechanism of inhibition.
PDB Compounds: (B:) A11 FAB light chain

SCOPe Domain Sequences for d3so3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3so3b1 b.1.1.1 (B:1-106A) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygastratgip
arfsgsgsgtdftltinslepedfavyycqqrsnwppgytfgqgtkveit

SCOPe Domain Coordinates for d3so3b1:

Click to download the PDB-style file with coordinates for d3so3b1.
(The format of our PDB-style files is described here.)

Timeline for d3so3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3so3b2
View in 3D
Domains from other chains:
(mouse over for more information)
d3so3a_