Lineage for d1bm3h1 (1bm3 H:1-125)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219122Species Anti-integrin Fab OPG2 (mouse), kappa L chain [48805] (2 PDB entries)
  8. 219123Domain d1bm3h1: 1bm3 H:1-125 [20067]
    Other proteins in same PDB: d1bm3h2, d1bm3l2

Details for d1bm3h1

PDB Entry: 1bm3 (more details), 2 Å

PDB Description: immunoglobulin opg2 fab-peptide complex

SCOP Domain Sequences for d1bm3h1:

Sequence, based on SEQRES records: (download)

>d1bm3h1 b.1.1.1 (H:1-125) Immunoglobulin (variable domains of L and H chains) {Anti-integrin Fab OPG2 (mouse), kappa L chain}
evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhpfyrydggnyyamdhwgqgts
vtvsa

Sequence, based on observed residues (ATOM records): (download)

>d1bm3h1 b.1.1.1 (H:1-125) Immunoglobulin (variable domains of L and H chains) {Anti-integrin Fab OPG2 (mouse), kappa L chain}
evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhamdhwgqgtsvtvsa

SCOP Domain Coordinates for d1bm3h1:

Click to download the PDB-style file with coordinates for d1bm3h1.
(The format of our PDB-style files is described here.)

Timeline for d1bm3h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bm3h2