Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries) |
Domain d1nmah_: 1nma H: [20065] Other proteins in same PDB: d1nmal_, d1nman_ part of Fab NC10; only Fv coordinates are included complexed with man, nag; mutant |
PDB Entry: 1nma (more details), 3 Å
SCOP Domain Sequences for d1nmah_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmah_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} evqlqqpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltv ss
Timeline for d1nmah_: