SCOPe 2.04: Domain d3sdko_: 3sdk O:

Lineage for d3sdko_ (3sdk O:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3sdko_: 3sdk O: [200648]
   Other proteins in same PDB: d3sdkb_, d3sdkd_, d3sdkf_, d3sdkp_, d3sdkr_, d3sdkt_
   automated match to d1jd2v_
   complexed with mes, mg, p3n

Details for d3sdko_

PDB Entry: 3sdk, 2.7 Å

PDB Description: structure of yeast 20s open-gate proteasome with compound 34

PDB Compounds: (O:) Proteasome component Y7

SCOPe Domain Sequences for d3sdko_:

Sequence; same for both SEQRES and ATOM records:

>d3sdko_ d.153.1.4 (O:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

Timeline for d3sdko_:

• d3sdko_ first appeared in SCOPe 2.03
  
• d3sdko_ appears in SCOPe 2.05
  
• d3sdko_ appears in the current release, SCOPe 2.08