SCOP 1.65: Domain d1nmal_: 1nma L:

Lineage for d1nmal_ (1nma L:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1nmal_: 1nma L: [20064]
   Other proteins in same PDB: d1nmah_, d1nman_
   part of Fab NC10; only Fv coordinates are included
   complexed with man, nag; mutant

Details for d1nmal_

PDB Entry: 1nma, 3 Å

PDB Description: n9 neuraminidase complexes with antibodies nc41 and nc10: empirical free-energy calculations capture specificity trends observed with mutant binding data

SCOP Domain Sequences for d1nmal_:

Sequence; same for both SEQRES and ATOM records:

>d1nmal_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirra

Timeline for d1nmal_:

• d1nmal_ first appeared (with stable ids) in SCOP 1.55
  
• d1nmal_ appears in SCOP 1.63
  
• d1nmal_ appears in SCOP 1.67
  
• d1nmal_ appears in the current release, SCOPe 2.08