SCOP 1.61: Domain d1nmbh_: 1nmb H:

Lineage for d1nmbh_ (1nmb H:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries)

8. Domain d1nmbh_: 1nmb H: [20063]
   Other proteins in same PDB: d1nmbn_

Details for d1nmbh_

PDB Entry: 1nmb, 2.5 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody

SCOP Domain Sequences for d1nmbh_:

Sequence; same for both SEQRES and ATOM records:

>d1nmbh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
qvqlqqpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltv
ss

Timeline for d1nmbh_:

• d1nmbh_ first appeared (with stable ids) in SCOP 1.55
  
• d1nmbh_ appears in SCOP 1.59
  
• d1nmbh_ appears in SCOP 1.63
  
• d1nmbh_ appears in the current release, SCOPe 2.08, called d1nmbh1