Lineage for d1nmbh_ (1nmb H:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52478Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries)
  8. 52485Domain d1nmbh_: 1nmb H: [20063]
    Other proteins in same PDB: d1nmbn_

Details for d1nmbh_

PDB Entry: 1nmb (more details), 2.5 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody

SCOP Domain Sequences for d1nmbh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmbh_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
qvqlqqpgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttltv
ss

SCOP Domain Coordinates for d1nmbh_:

Click to download the PDB-style file with coordinates for d1nmbh_.
(The format of our PDB-style files is described here.)

Timeline for d1nmbh_: