Lineage for d1nmbl_ (1nmb L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 288075Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)
  8. 288185Domain d1nmbl_: 1nmb L: [20062]
    Other proteins in same PDB: d1nmbh_, d1nmbn_
    part of Fab NC10; only Fv coordinates are included
    complexed with ca, man, nag; mutant

Details for d1nmbl_

PDB Entry: 1nmb (more details), 2.5 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody

SCOP Domain Sequences for d1nmbl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmbl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirra

SCOP Domain Coordinates for d1nmbl_:

Click to download the PDB-style file with coordinates for d1nmbl_.
(The format of our PDB-style files is described here.)

Timeline for d1nmbl_: