Lineage for d1nmbl_ (1nmb L:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158310Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries)
  8. 158318Domain d1nmbl_: 1nmb L: [20062]
    Other proteins in same PDB: d1nmbn_

Details for d1nmbl_

PDB Entry: 1nmb (more details), 2.5 Å

PDB Description: the structure of a complex between the nc10 antibody and influenza virus neuraminidase and comparison with the overlapping binding site of the nc41 antibody

SCOP Domain Sequences for d1nmbl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmbl_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirra

SCOP Domain Coordinates for d1nmbl_:

Click to download the PDB-style file with coordinates for d1nmbl_.
(The format of our PDB-style files is described here.)

Timeline for d1nmbl_: