Lineage for d3sdad2 (3sda D:119-243)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031222Domain d3sdad2: 3sda D:119-243 [200619]
    Other proteins in same PDB: d3sdaa1, d3sdaa3, d3sdab_, d3sdac1, d3sdad1
    automated match to d1ktke2
    complexed with gcy, gol, nag

Details for d3sdad2

PDB Entry: 3sda (more details), 2.8 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-beta-galactosylceramide
PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3sdad2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sdad2 b.1.1.2 (D:119-243) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeaw

SCOPe Domain Coordinates for d3sdad2:

Click to download the PDB-style file with coordinates for d3sdad2.
(The format of our PDB-style files is described here.)

Timeline for d3sdad2: