SCOPe 2.07: Domain d3scmd1: 3scm D:1-118

Lineage for d3scmd1 (3scm D:1-118)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3scmd1: 3scm D:1-118 [200610]
   Other proteins in same PDB: d3scma1, d3scma2, d3scma3, d3scmb_, d3scmc2, d3scmd2
   automated match to d1ktke1
   complexed with lgn, nag

Details for d3scmd1

PDB Entry: 3scm, 2.5 Å

PDB Description: crystal structure of autoreactive-valpha14-vbeta6 nkt tcr in complex with cd1d-isoglobotrihexosylceramide

PDB Compounds: (D:) NKT TCR autoreactive-Vbeta6 chain

SCOPe Domain Sequences for d3scmd1:

Sequence; same for both SEQRES and ATOM records:

>d3scmd1 b.1.1.0 (D:1-118) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ggiitqtpkfligqegqkltlkcqqnfnhdtmywyrqdsgkglrliyysygagstekgdl
segydasrekkssfsltvtsaqknemavflcasgslldvrevffgkgtrltvve

Timeline for d3scmd1:

• d3scmd1 first appeared in SCOPe 2.03
  
• d3scmd1 appears in SCOPe 2.06
  
• d3scmd1 appears in the current release, SCOPe 2.08