Lineage for d1a14h_ (1a14 H:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102830Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries)
  8. 102831Domain d1a14h_: 1a14 H: [20061]
    Other proteins in same PDB: d1a14n_

Details for d1a14h_

PDB Entry: 1a14 (more details), 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 5 residue linker and influenza virus neuraminidase

SCOP Domain Sequences for d1a14h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a14h_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv

SCOP Domain Coordinates for d1a14h_:

Click to download the PDB-style file with coordinates for d1a14h_.
(The format of our PDB-style files is described here.)

Timeline for d1a14h_: