| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries) |
| Domain d1a14h_: 1a14 H: [20061] Other proteins in same PDB: d1a14n_ |
PDB Entry: 1a14 (more details), 2.5 Å
SCOP Domain Sequences for d1a14h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a14h_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
Timeline for d1a14h_: